Quick Answer: Whats A Good Name For A Cleaning Company?

What makes a cleaning company stand out?

Pricing and Value.

Of course, the most obvious way to stand out from other companies is in your pricing.

However, you can’t price yourself so low that you aren’t able to pay your employees or make a living.

Instead, focus on the value that you bring to your customers..

How do I name my cleaning business?

One of the first things you need to do when starting a cleaning business is picking your business name….Cleaning Service Name Ideas List.Maid in TimeClean RightStar CleaningFriendly CleanMaid SparkleHappy MaidsFriendly MaidsMaid to WorkDependable CleanThe Maid Squad4 more rows•Mar 10, 2020

How do you name a company?

Here are 12 helpful suggestions on how to come up with a winning name for your business:Avoid hard-to-spell names. … Don’t pick a name that could be limiting as your business grows. … Conduct a thorough Internet search. … Get the .com domain name. … Use a name that conveys some meaning. … Conduct a trademark search.More items…•

How do I start my own cleaning business from scratch?

How to Start a Cleaning Business in 7 StepsStep 1: Fund your cleaning business. … Step 2: Choose your market. … Step 3: Find your specialty—and stick to it. … Step 4: Plan your cleaning business budget. … Step 5: Register your cleaning business. … Step 6: Find and maintain clients. … Step 7: Invest in advertising and expanding.

How would you describe your cleaning business?

A cleaning business description should be in your cleaning business plan, but it can also be used to advertise to customers. This description should include your basic information, company mission, the services you offer, and the responsibilities your cleaners recognize when they provide those services.

What is the name of toilet cleaner?

Top 10 Toilet Cleaners LiquidToilet Cleaners Liquid NAMEPRICEHarpic Bathroom Cleaner – Floral 500 mlRs.285Leeford Toilet Seat Sanitizer Spray Toilet Cleaner ( 2 Pc x 75 ml ) Lemon Spray Toilet Cleaner(2 x 75 ml)Rs.189everteen Instant Toilet Seat Sanitizer Spray for Women 90ml Floral Spray Toilet Cleaner(90 ml)Rs.1764 more rows

What are clean words?

Synonymsclean. adjective. not dirty.sterile. adjective. completely clean, with no bacteria.immaculate. adjective. so clean and tidy that there is no dirt.hygienic. adjective. clean and not likely to cause illness or disease.spotless. adjective. extremely clean.pristine. adjective. … polished. adjective. … fresh. adjective.More items…

What is another word for cleaning service?

What is another word for cleaning service?cleaning womanhousemaidhousekeepermaidmaidservantdailycharwomanhousecleanercleaning ladydaily woman78 more rows

How do I write a cleaning bid?

Include in your bid details of the job that factored into the bid amount (tasks, size/layout and circumstances), the estimated time it will take to complete the job and the hourly charge (if charging per hour), the cleaning schedule and the total amount you will charge the customer for the cleaning job.

What is the politically correct term for cleaning lady?

Originally Answered: Which one is the most politically correct term: cleaning lady, housekeeper, or maid? Housekeeper seems more politically correct since there’s nothing to suggest male or female that is in cleaning lady or maid.

How do I choose a name for myself?

Think about the identity that you intend to cultivate, and choose a name that fits with your vision for the new you. You may have connotations about certain names: tough, sweet, adventurous, etc. Pick a name that helps you become who you want to become. Name yourself after someone inspiring.

How do I get my first cleaning client?

Here’s How to Get New Cleaning ClientsTip # 1 – Know your ideal client.Tip # 2 – Develop a marketing plan.Tip # 3 – Remember your current relationships are a jumping off point.Tip # 4 – Build credibility and your network.Tip # 5 – Raise your prices.Tip # 6 – Articulate your VALUE PROPOSITION.

What words Cannot be used in a company name?

Words not Allowed in Company NameBoard.Commission.Authority.Undertaking.National.Union.Central.Federal.More items…

How do I create a catchy business name?

How to come up with a business nameUse acronyms.Create mash-ups.Get inspiration from mythology and literature.Use foreign words.Use your own name.Take a look at a map.Mix things up.Partner with another company.More items…